Lineage for d4uhpc_ (4uhp C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174327Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2174328Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2174470Family d.4.1.0: automated matches [273673] (1 protein)
    not a true family
  6. 2174471Protein automated matches [273674] (1 species)
    not a true protein
  7. 2174472Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273675] (3 PDB entries)
  8. 2174480Domain d4uhpc_: 4uhp C: [275680]
    Other proteins in same PDB: d4uhpb_, d4uhpd_, d4uhpf1, d4uhpf2, d4uhph1, d4uhph2
    automated match to d1fr2b_
    protein/DNA complex

Details for d4uhpc_

PDB Entry: 4uhp (more details), 2 Å

PDB Description: crystal structure of the pyocin ap41 dnase-immunity complex
PDB Compounds: (C:) large component of pyocin ap41

SCOPe Domain Sequences for d4uhpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhpc_ d.4.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
epgvatgngqpvtgnwlagasqgdgvpipsqiadqlrgkefkswrdfreqfwmavskdps
alenlspsnryfvsqglapyavpeehlgskekfeihhvvplesggalynidnlvivtpkr
hseihkel

SCOPe Domain Coordinates for d4uhpc_:

Click to download the PDB-style file with coordinates for d4uhpc_.
(The format of our PDB-style files is described here.)

Timeline for d4uhpc_: