| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) ![]() common motif contains conserved histidine residue and metal-binding site |
| Family d.4.1.0: automated matches [273673] (1 protein) not a true family |
| Protein automated matches [273674] (1 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [273675] (3 PDB entries) |
| Domain d4uhpa_: 4uhp A: [275679] Other proteins in same PDB: d4uhpb_, d4uhpd_, d4uhpf1, d4uhpf2, d4uhph1, d4uhph2 automated match to d1fr2b_ protein/DNA complex |
PDB Entry: 4uhp (more details), 2 Å
SCOPe Domain Sequences for d4uhpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uhpa_ d.4.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
depgvatgngqpvtgnwlagasqgdgvpipsqiadqlrgkefkswrdfreqfwmavskdp
salenlspsnryfvsqglapyavpeehlgskekfeihhvvplesggalynidnlvivtpk
rhseihkelklkrke
Timeline for d4uhpa_: