Lineage for d4uhpa_ (4uhp A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1889894Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1889895Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1890037Family d.4.1.0: automated matches [273673] (1 protein)
    not a true family
  6. 1890038Protein automated matches [273674] (1 species)
    not a true protein
  7. 1890039Species Pseudomonas aeruginosa [TaxId:208964] [273675] (3 PDB entries)
  8. 1890046Domain d4uhpa_: 4uhp A: [275679]
    Other proteins in same PDB: d4uhpb_, d4uhpd_, d4uhpf_, d4uhph_
    automated match to d1fr2b_
    protein/DNA complex

Details for d4uhpa_

PDB Entry: 4uhp (more details), 2 Å

PDB Description: crystal structure of the pyocin ap41 dnase-immunity complex
PDB Compounds: (A:) large component of pyocin ap41

SCOPe Domain Sequences for d4uhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhpa_ d.4.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
depgvatgngqpvtgnwlagasqgdgvpipsqiadqlrgkefkswrdfreqfwmavskdp
salenlspsnryfvsqglapyavpeehlgskekfeihhvvplesggalynidnlvivtpk
rhseihkelklkrke

SCOPe Domain Coordinates for d4uhpa_:

Click to download the PDB-style file with coordinates for d4uhpa_.
(The format of our PDB-style files is described here.)

Timeline for d4uhpa_: