Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909] [275642] (6 PDB entries) |
Domain d4u62f1: 4u62 F:33-303 [275663] Other proteins in same PDB: d4u62d2, d4u62f2 automated match to d4mbzj_ complexed with edo, gol, sia |
PDB Entry: 4u62 (more details), 1.55 Å
SCOPe Domain Sequences for d4u62f1:
Sequence, based on SEQRES records: (download)
>d4u62f1 b.121.6.1 (F:33-303) automated matches {Trichodysplasia spinulosa-associated polyomavirus [TaxId: 862909]} ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys tarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmn fhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpve cwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdi vgflvgkdgdmqyrglpryfnillrkrtvrn
>d4u62f1 b.121.6.1 (F:33-303) automated matches {Trichodysplasia spinulosa-associated polyomavirus [TaxId: 862909]} ievlnlvtsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptystar inlpmlntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfavgge plelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpdpskn entryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflvgkdg dmqyrglpryfnillrkrtvrn
Timeline for d4u62f1: