Lineage for d6nn9__ (6nn9 -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62716Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 62717Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 62718Protein Influenza neuraminidase [50943] (2 species)
  7. 62719Species Influenza A virus, different strains [TaxId:11320] [50944] (45 PDB entries)
  8. 62743Domain d6nn9__: 6nn9 - [27565]

Details for d6nn9__

PDB Entry: 6nn9 (more details), 2.3 Å

PDB Description: refined atomic structures of n9 subtype influenza virus neuraminidase and escape mutants

SCOP Domain Sequences for d6nn9__:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nn9__ b.68.1.1 (-) Influenza neuraminidase {Influenza A virus, different strains}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpnedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d6nn9__:

Click to download the PDB-style file with coordinates for d6nn9__.
(The format of our PDB-style files is described here.)

Timeline for d6nn9__: