Lineage for d2bat__ (2bat -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301738Fold b.68: 6-bladed beta-propeller [50938] (8 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 301739Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 301740Family b.68.1.1: Sialidases (neuraminidases) [50940] (7 proteins)
  6. 301741Protein Influenza neuraminidase [50943] (2 species)
  7. 301742Species Influenza A virus, different strains [TaxId:11320] [50944] (48 PDB entries)
  8. 301767Domain d2bat__: 2bat - [27564]
    complexed with ca, fuc, man, nag, ngl, sia

Details for d2bat__

PDB Entry: 2bat (more details), 2 Å

PDB Description: the structure of the complex between influenza virus neuraminidase and sialic acid, the viral receptor

SCOP Domain Sequences for d2bat__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bat__ b.68.1.1 (-) Influenza neuraminidase {Influenza A virus, different strains}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrnpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOP Domain Coordinates for d2bat__:

Click to download the PDB-style file with coordinates for d2bat__.
(The format of our PDB-style files is described here.)

Timeline for d2bat__: