Lineage for d2bat__ (2bat -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies) Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins) 
Protein Influenza neuraminidase [50943] (2 species) Species Influenza A virus, different strains [TaxId:11320] [50944] (45 PDB entries) 
Domain d2bat__: 2bat - [27564]
Details for d2bat__
PDB Entry: 2bat (more details), 2 Å
PDB Description: the structure of the complex between influenza virus neuraminidase and sialic acid, the viral receptor
SCOP Domain Sequences for d2bat__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bat__ b.68.1.1 (-) Influenza neuraminidase {Influenza A virus, different strains}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrnpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi
SCOP Domain Coordinates for d2bat__:
Click to download the PDB-style file with coordinates for d2bat__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bat__:
- d2bat__ first appeared (with stable ids) in SCOP 1.55
- d2bat__ appears in SCOP 1.57
- d2bat__ appears in SCOP 1.61
- d2bat__ appears in the current release, SCOPe 2.08, called d2bata_
View in 3D