SCOPe 2.08: Domain d4qhua1: 4qhu A:3-109

Lineage for d4qhua1 (4qhu A:3-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4qhua1: 4qhu A:3-109 [275638]
   Other proteins in same PDB: d4qhua2, d4qhub_, d4qhuh_, d4qhul2
   automated match to d1aqkl1
   complexed with cl, gol, so4

Details for d4qhua1

PDB Entry: 4qhu, 2.2 Å

PDB Description: crystal structure of il-17a/fab6785 complex

PDB Compounds: (A:) Fab6785 light chain

SCOPe Domain Sequences for d4qhua1:

Sequence; same for both SEQRES and ATOM records:

>d4qhua1 b.1.1.0 (A:3-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsvapgqtariscsgdnlgdkyanwyqqkpgqapvlviyddidrpsgiperfs
gsnsgntatltisgtqaedeadyycgsydfflgmivfgggtkltvlg

Timeline for d4qhua1:

• d4qhua1 first appeared in SCOPe 2.05
  
• d4qhua1 appears in SCOPe 2.07