Lineage for d5nn9__ (5nn9 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17045Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 17046Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins)
  6. 17047Protein Influenza neuraminidase [50943] (2 species)
  7. 17048Species Influenza A virus, different strains [TaxId:11320] [50944] (41 PDB entries)
  8. 17065Domain d5nn9__: 5nn9 - [27563]

Details for d5nn9__

PDB Entry: 5nn9 (more details), 2.3 Å

PDB Description: refined atomic structures of n9 subtype influenza virus neuraminidase and escape mutants

SCOP Domain Sequences for d5nn9__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nn9__ b.68.1.1 (-) Influenza neuraminidase {Influenza A virus, different strains}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisidsrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d5nn9__:

Click to download the PDB-style file with coordinates for d5nn9__.
(The format of our PDB-style files is described here.)

Timeline for d5nn9__: