Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries) Uniprot P00044 |
Domain d4qaoa1: 4qao A:-2-101 [275628] Other proteins in same PDB: d4qaoa2, d4qaob2, d4qaoc2 automated match to d4mu8a_ complexed with hem |
PDB Entry: 4qao (more details), 2.1 Å
SCOPe Domain Sequences for d4qaoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qaoa1 a.3.1.1 (A:-2-101) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkka
Timeline for d4qaoa1:
View in 3D Domains from other chains: (mouse over for more information) d4qaob1, d4qaob2, d4qaoc1, d4qaoc2 |