![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Mitochondrial cytochrome c [46642] (7 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries) Uniprot P00044 |
![]() | Domain d4qaob1: 4qao B:-2-101 [275627] Other proteins in same PDB: d4qaoa2, d4qaob2, d4qaoc2 automated match to d4mu8a_ complexed with hem |
PDB Entry: 4qao (more details), 2.1 Å
SCOPe Domain Sequences for d4qaob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qaob1 a.3.1.1 (B:-2-101) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkka
Timeline for d4qaob1:
![]() Domains from other chains: (mouse over for more information) d4qaoa1, d4qaoa2, d4qaoc1, d4qaoc2 |