SCOPe 2.07: Domain d4qaoc1: 4qao C:-2-101

Lineage for d4qaoc1 (4qao C:-2-101)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
   Uniprot P00044

8. Domain d4qaoc1: 4qao C:-2-101 [275626]
   Other proteins in same PDB: d4qaoa2, d4qaob2, d4qaoc2
   automated match to d4mu8a_
   complexed with hem

Details for d4qaoc1

PDB Entry: 4qao, 2.1 Å

PDB Description: lysine-ligated cytochrome c with f82h

PDB Compounds: (C:) Cytochrome c iso-1

SCOPe Domain Sequences for d4qaoc1:

Sequence; same for both SEQRES and ATOM records:

>d4qaoc1 a.3.1.1 (C:-2-101) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkka

Timeline for d4qaoc1:

• d4qaoc1 first appeared in SCOPe 2.05, called d4qaoc_
  
• d4qaoc1 appears in SCOPe 2.06
  
• d4qaoc1 appears in the current release, SCOPe 2.08