Lineage for d4qaoc_ (4qao C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719846Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1719847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
    Uniprot P00044
  8. 1719898Domain d4qaoc_: 4qao C: [275626]
    automated match to d4mu8a_
    complexed with hem

Details for d4qaoc_

PDB Entry: 4qao (more details), 2.1 Å

PDB Description: lysine-ligated cytochrome c with f82h
PDB Compounds: (C:) Cytochrome c iso-1

SCOPe Domain Sequences for d4qaoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qaoc_ a.3.1.1 (C:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkkase

SCOPe Domain Coordinates for d4qaoc_:

Click to download the PDB-style file with coordinates for d4qaoc_.
(The format of our PDB-style files is described here.)

Timeline for d4qaoc_:

  • d4qaoc_ appears in periodic updates to SCOPe 2.05 starting on 2015-08-05
  • d4qaoc_ is called d4qaoc1 in SCOPe 2.06
  • d4qaoc_ appears in the current release, SCOPe 2.07, called d4qaoc1