SCOPe 2.05: Domain d4qaoc_: 4qao C:

Lineage for d4qaoc_ (4qao C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
   Uniprot P00044

8. Domain d4qaoc_: 4qao C: [275626]
   automated match to d4mu8a_
   complexed with hem

Details for d4qaoc_

PDB Entry: 4qao, 2.1 Å

PDB Description: lysine-ligated cytochrome c with f82h

PDB Compounds: (C:) Cytochrome c iso-1

SCOPe Domain Sequences for d4qaoc_:

Sequence; same for both SEQRES and ATOM records:

>d4qaoc_ a.3.1.1 (C:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkkase

Timeline for d4qaoc_:

• d4qaoc_ is new in SCOPe 2.05-stable
  
• d4qaoc_ is called d4qaoc1 in SCOPe 2.06
  
• d4qaoc_ appears in the current release, SCOPe 2.08, called d4qaoc1