| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Mitochondrial cytochrome c [46642] (6 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries) Uniprot P00044 |
| Domain d4qaoc_: 4qao C: [275626] automated match to d4mu8a_ complexed with hem |
PDB Entry: 4qao (more details), 2.1 Å
SCOPe Domain Sequences for d4qaoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qaoc_ a.3.1.1 (C:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkkase
Timeline for d4qaoc_: