SCOPe 2.06: Domain d4okia1: 4oki A:670-849

Lineage for d4okia1 (4oki A:670-849)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein automated matches [275621] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [275622] (1 PDB entry)

8. Domain d4okia1: 4oki A:670-849 [275624]
   Other proteins in same PDB: d4okia2
   automated match to d1pqwa_
   complexed with mpd, na

Details for d4okia1

PDB Entry: 4oki, 1.5 Å

PDB Description: x-ray structure of the nucleotide-binding subdomain of the enoylreductase domain of ppsc from mycobacterium tuberculosis

PDB Compounds: (A:) Phthiocerol synthesis polyketide synthase type I PpsC

SCOPe Domain Sequences for d4okia1:

Sequence; same for both SEQRES and ATOM records:

>d4okia1 c.2.1.1 (A:670-849) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
neaatfgvayltawhslcevgrlspgervlihsatggvgmaavsiakmigariyttagsd
akremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageaiqrgvqilapggrf
ielgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqhilqhvadgklevl

Timeline for d4okia1:

• d4okia1 first appeared in SCOPe 2.05, called d4okia_
  
• d4okia1 appears in SCOPe 2.07
  
• d4okia1 appears in the current release, SCOPe 2.08