SCOPe 2.05: Domain d4okib_: 4oki B:

Lineage for d4okib_ (4oki B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein automated matches [275621] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [275622] (1 PDB entry)

8. Domain d4okib_: 4oki B: [275623]
   automated match to d1pqwa_
   complexed with mpd, na

Details for d4okib_

PDB Entry: 4oki, 1.5 Å

PDB Description: x-ray structure of the nucleotide-binding subdomain of the enoylreductase domain of ppsc from mycobacterium tuberculosis

PDB Compounds: (B:) Phthiocerol synthesis polyketide synthase type I PpsC

SCOPe Domain Sequences for d4okib_:

Sequence; same for both SEQRES and ATOM records:

>d4okib_ c.2.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eaatfgvayltawhslcevgrlspgervlihsatggvgmaavsiakmigariyttagsda
kremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageaiqrgvqilapggrfi
elgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqhilqhvadgklevl

Timeline for d4okib_:

• d4okib_ is new in SCOPe 2.05-stable
  
• d4okib_ appears in SCOPe 2.06
  
• d4okib_ appears in the current release, SCOPe 2.08