Lineage for d2mypa_ (2myp A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851592Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1851593Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 1851651Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 1851652Protein automated matches [190574] (15 species)
    not a true protein
  7. 1851700Species Synechocystis sp. [TaxId:1111708] [275616] (4 PDB entries)
  8. 1851703Domain d2mypa_: 2myp A: [275617]
    automated match to d3rh0b_

Details for d2mypa_

PDB Entry: 2myp (more details)

PDB Description: an arsenate reductase in the phosphate binding state
PDB Compounds: (A:) Glutaredoxin arsenate reductase

SCOPe Domain Sequences for d2mypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mypa_ c.44.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mkkvmfvckrnscrsqmaegfaktlgagkiavtscglessrvhptaiammeevgidisgq
tsdpienfnaddydvvislcgcgvnlppewvtqeifedwqledpdgqslevfrtvrgqvk
ervenliakis

SCOPe Domain Coordinates for d2mypa_:

Click to download the PDB-style file with coordinates for d2mypa_.
(The format of our PDB-style files is described here.)

Timeline for d2mypa_: