Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.0: automated matches [191415] (1 protein) not a true family |
Protein automated matches [190574] (15 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [275616] (4 PDB entries) |
Domain d2mypa_: 2myp A: [275617] automated match to d3rh0b_ |
PDB Entry: 2myp (more details)
SCOPe Domain Sequences for d2mypa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mypa_ c.44.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]} mkkvmfvckrnscrsqmaegfaktlgagkiavtscglessrvhptaiammeevgidisgq tsdpienfnaddydvvislcgcgvnlppewvtqeifedwqledpdgqslevfrtvrgqvk ervenliakis
Timeline for d2mypa_: