Lineage for d5cp7g2 (5cp7 G:113-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753329Domain d5cp7g2: 5cp7 G:113-218 [275613]
    Other proteins in same PDB: d5cp7a1, d5cp7b_, d5cp7c1, d5cp7d_, d5cp7e1, d5cp7f_, d5cp7g1, d5cp7h_
    automated match to d3mbxl2

Details for d5cp7g2

PDB Entry: 5cp7 (more details), 3.01 Å

PDB Description: crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
PDB Compounds: (G:) Light Chain of Antigen-Binding Fragment of Monoclonal Antibody of 4C7

SCOPe Domain Sequences for d5cp7g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cp7g2 b.1.1.2 (G:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd
skdstysmsstltltkdeyerhntytceathktstspivksfnrne

SCOPe Domain Coordinates for d5cp7g2:

Click to download the PDB-style file with coordinates for d5cp7g2.
(The format of our PDB-style files is described here.)

Timeline for d5cp7g2: