Lineage for d5cp7e1 (5cp7 E:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035483Domain d5cp7e1: 5cp7 E:1-112 [275610]
    Other proteins in same PDB: d5cp7a2, d5cp7c2, d5cp7e2, d5cp7g2
    automated match to d2g2ra1

Details for d5cp7e1

PDB Entry: 5cp7 (more details), 3.01 Å

PDB Description: crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
PDB Compounds: (E:) Light Chain of Antigen-Binding Fragment of Monoclonal Antibody of 4C7

SCOPe Domain Sequences for d5cp7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cp7e1 b.1.1.0 (E:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpitlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
srvpdrftgsgagtdftlkisrveaedlgiyycwqgthfpqtfgggtkleik

SCOPe Domain Coordinates for d5cp7e1:

Click to download the PDB-style file with coordinates for d5cp7e1.
(The format of our PDB-style files is described here.)

Timeline for d5cp7e1: