SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5cp7a2 (5cp7 A:113-218)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (12 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (451 PDB entries)
  8. 2026050Domain d5cp7a2: 5cp7 A:113-218 [275608]
    Other proteins in same PDB: d5cp7a1, d5cp7c1, d5cp7e1, d5cp7g1
    automated match to d3mbxl2

Details for d5cp7a2

PDB Entry: 5cp7 (more details), 3.01 Å

PDB Description: crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
PDB Compounds: (A:) Light Chain of Antigen-Binding Fragment of Monoclonal Antibody of 4C7

SCOPe Domain Sequences for d5cp7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cp7a2 b.1.1.2 (A:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd
skdstysmsstltltkdeyerhntytceathktstspivksfnrne

SCOPe Domain Coordinates for d5cp7a2:

Click to download the PDB-style file with coordinates for d5cp7a2.
(The format of our PDB-style files is described here.)

Timeline for d5cp7a2: