SCOPe 2.08: Domain d5cqea1: 5cqe A:1-158

Lineage for d5cqea1 (5cqe A:1-158)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (4 species)
   not a true protein

7. Species Influenza A virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [275598] (1 PDB entry)

8. Domain d5cqea1: 5cqe A:1-158 [275600]
   Other proteins in same PDB: d5cqea2, d5cqeb2
   automated match to d2z16a_
   complexed with cl, edo, peg, trs

Details for d5cqea1

PDB Entry: 5cqe, 2.1 Å

PDB Description: 2.1 angstrom resolution crystal structure of matrix protein 1 (m1; residues 1-164) from influenza a virus (a/puerto rico/8/34(h1n1))

PDB Compounds: (A:) matrix protein 1

SCOPe Domain Sequences for d5cqea1:

Sequence, based on SEQRES records:

>d5cqea1 a.95.1.1 (A:1-158) automated matches {Influenza A virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
mslltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsys
agalascmgliynrmgavttevafglvcatceqiadsq

Sequence, based on observed residues (ATOM records):

>d5cqea1 a.95.1.1 (A:1-158) automated matches {Influenza A virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
mslltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
gfvftltvpseglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsysa
galascmgliynrmgavttevafglvcatceqiadsq

Timeline for d5cqea1:

• d5cqea1 first appeared in SCOPe 2.05, called d5cqea_
  
• d5cqea1 appears in SCOPe 2.07