Lineage for d5cqeb1 (5cqe B:1-159)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720943Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
    multihelical; consists of two different all-alpha subdomains, 4 helices each
  4. 2720944Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) (S)
    superficially similar to membrane translocation domains
    automatically mapped to Pfam PF00598
  5. 2720945Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)
  6. 2720952Protein automated matches [190930] (4 species)
    not a true protein
  7. 2720953Species Influenza A virus (strain a/puerto rico/8/1934 h1n1) [TaxId:211044] [275598] (1 PDB entry)
  8. 2720955Domain d5cqeb1: 5cqe B:1-159 [275599]
    Other proteins in same PDB: d5cqea2, d5cqeb2
    automated match to d2z16a_
    complexed with cl, edo, peg, trs

Details for d5cqeb1

PDB Entry: 5cqe (more details), 2.1 Å

PDB Description: 2.1 angstrom resolution crystal structure of matrix protein 1 (m1; residues 1-164) from influenza a virus (a/puerto rico/8/34(h1n1))
PDB Compounds: (B:) matrix protein 1

SCOPe Domain Sequences for d5cqeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cqeb1 a.95.1.1 (B:1-159) automated matches {Influenza A virus (strain a/puerto rico/8/1934 h1n1) [TaxId: 211044]}
mslltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsys
agalascmgliynrmgavttevafglvcatceqiadsqh

SCOPe Domain Coordinates for d5cqeb1:

Click to download the PDB-style file with coordinates for d5cqeb1.
(The format of our PDB-style files is described here.)

Timeline for d5cqeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cqeb2