Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries) |
Domain d5c9kh_: 5c9k H: [275596] automated match to d2mkwa_ complexed with act; mutant |
PDB Entry: 5c9k (more details), 1.92 Å
SCOPe Domain Sequences for d5c9kh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c9kh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
Timeline for d5c9kh_: