SCOPe 2.07: Domain d5c1mb_: 5c1m B:

Lineage for d5c1mb_ (5c1m B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d5c1mb_: 5c1m B: [275587]
   automated match to d4jvpa_
   complexed with 4vo, clr, olc, p6g, po4

Details for d5c1mb_

PDB Entry: 5c1m, 2.1 Å

PDB Description: crystal structure of active mu-opioid receptor bound to the agonist bu72

PDB Compounds: (B:) Nanobody 39

SCOPe Domain Sequences for d5c1mb_:

Sequence, based on SEQRES records:

>d5c1mb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyad
svadrfttsrdvanntlylqmnslkhedtavyycaarapvgqssspydydywgqgtqvtv
ssaaa

Sequence, based on observed residues (ATOM records):

>d5c1mb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyad
svadrfttsrdvanntlylqmnslkhedtavyycaarapvdydywgqgtqvtvssaaa

Timeline for d5c1mb_:

• d5c1mb_ first appeared in SCOPe 2.05
  
• d5c1mb_ appears in SCOPe 2.06
  
• d5c1mb_ appears in the current release, SCOPe 2.08, called d5c1mb1