SCOPe 2.08: Domain d5c1mb1: 5c1m B:16-127

Lineage for d5c1mb1 (5c1m B:16-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5c1mb1: 5c1m B:16-127 [275587]
   Other proteins in same PDB: d5c1ma_, d5c1mb2
   automated match to d4jvpa_
   complexed with clr, olc, p6g, po4, vf1

Details for d5c1mb1

PDB Entry: 5c1m, 2.07 Å

PDB Description: crystal structure of active mu-opioid receptor bound to the agonist bu72

PDB Compounds: (B:) Nanobody 39

SCOPe Domain Sequences for d5c1mb1:

Sequence, based on SEQRES records:

>d5c1mb1 b.1.1.1 (B:16-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
pggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyadsvadrfttsrdva
nntlylqmnslkhedtavyycaarapvgqssspydydywgqgtqvtvssaaa

Sequence, based on observed residues (ATOM records):

>d5c1mb1 b.1.1.1 (B:16-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
pggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyadsvadrfttsrdva
nntlylqmnslkhedtavyycaarapvdydywgqgtqvtvssaaa

Timeline for d5c1mb1:

• d5c1mb1 first appeared in SCOPe 2.05, called d5c1mb_
  
• d5c1mb1 was called d5c1mb_ in SCOPe 2.07