| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
| Domain d5c1mb1: 5c1m B:16-127 [275587] Other proteins in same PDB: d5c1ma_, d5c1mb2 automated match to d4jvpa_ complexed with clr, olc, p6g, po4, vf1 |
PDB Entry: 5c1m (more details), 2.07 Å
SCOPe Domain Sequences for d5c1mb1:
Sequence, based on SEQRES records: (download)
>d5c1mb1 b.1.1.1 (B:16-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
pggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyadsvadrfttsrdva
nntlylqmnslkhedtavyycaarapvgqssspydydywgqgtqvtvssaaa
>d5c1mb1 b.1.1.1 (B:16-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
pggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyadsvadrfttsrdva
nntlylqmnslkhedtavyycaarapvdydywgqgtqvtvssaaa
Timeline for d5c1mb1: