![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.0: automated matches [230426] (1 protein) not a true family |
![]() | Protein automated matches [230427] (2 species) not a true protein |
![]() | Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries) |
![]() | Domain d5c2tb2: 5c2t B:139-282 [275581] Other proteins in same PDB: d5c2tb1, d5c2tf1 automated match to d3vrbb2 complexed with 4yp, eph, f3s, fad, fes, hem, mli, sf4 |
PDB Entry: 5c2t (more details), 2.75 Å
SCOPe Domain Sequences for d5c2tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c2tb2 a.1.2.0 (B:139-282) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]} mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara igeikmlltkmktkpaplptpanf
Timeline for d5c2tb2: