Lineage for d5c2tb1 (5c2t B:33-138)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894403Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 1894404Protein automated matches [191164] (14 species)
    not a true protein
  7. 1894442Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (7 PDB entries)
  8. 1894451Domain d5c2tb1: 5c2t B:33-138 [275580]
    Other proteins in same PDB: d5c2tb2, d5c2tf2
    automated match to d3vrbb1
    complexed with 4yp, eph, f3s, fad, fes, hem, mli, sf4

Details for d5c2tb1

PDB Entry: 5c2t (more details), 2.75 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d5c2tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c2tb1 d.15.4.0 (B:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd

SCOPe Domain Coordinates for d5c2tb1:

Click to download the PDB-style file with coordinates for d5c2tb1.
(The format of our PDB-style files is described here.)

Timeline for d5c2tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c2tb2