Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (14 species) not a true protein |
Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (7 PDB entries) |
Domain d5c2tb1: 5c2t B:33-138 [275580] Other proteins in same PDB: d5c2tb2, d5c2tf2 automated match to d3vrbb1 complexed with 4yp, eph, f3s, fad, fes, hem, mli, sf4 |
PDB Entry: 5c2t (more details), 2.75 Å
SCOPe Domain Sequences for d5c2tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c2tb1 d.15.4.0 (B:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]} kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd
Timeline for d5c2tb1: