Lineage for d5bvqa_ (5bvq A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800288Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1800547Protein automated matches [190295] (6 species)
    not a true protein
  7. 1800612Species Pygoscelis papua [TaxId:30457] [275573] (2 PDB entries)
  8. 1800613Domain d5bvqa_: 5bvq A: [275577]
    automated match to d4nnsa_

Details for d5bvqa_

PDB Entry: 5bvq (more details), 2.1 Å

PDB Description: ligand-unbound pfabp4
PDB Compounds: (A:) fatty acid-binding protein

SCOPe Domain Sequences for d5bvqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bvqa_ b.60.1.2 (A:) automated matches {Pygoscelis papua [TaxId: 30457]}
mcdqfvgtwkflssenfedymkelgvgfatrkmagvakpnvtisingdvitiktestfkn
tevsfrlgeefdettaddrktknvitldngilnqvqkwdgketvikrkvmdgnlvvectm
ntvtskrvyera

SCOPe Domain Coordinates for d5bvqa_:

Click to download the PDB-style file with coordinates for d5bvqa_.
(The format of our PDB-style files is described here.)

Timeline for d5bvqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5bvqb_