SCOPe 2.05: Domain d5bvqa_: 5bvq A:

Lineage for d5bvqa_ (5bvq A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Pygoscelis papua [TaxId:30457] [275573] (2 PDB entries)

8. Domain d5bvqa_: 5bvq A: [275577]
   automated match to d4nnsa_

Details for d5bvqa_

PDB Entry: 5bvq, 2.1 Å

PDB Description: ligand-unbound pfabp4

PDB Compounds: (A:) fatty acid-binding protein

SCOPe Domain Sequences for d5bvqa_:

Sequence; same for both SEQRES and ATOM records:

>d5bvqa_ b.60.1.2 (A:) automated matches {Pygoscelis papua [TaxId: 30457]}
mcdqfvgtwkflssenfedymkelgvgfatrkmagvakpnvtisingdvitiktestfkn
tevsfrlgeefdettaddrktknvitldngilnqvqkwdgketvikrkvmdgnlvvectm
ntvtskrvyera

Timeline for d5bvqa_:

• d5bvqa_ is new in SCOPe 2.05-stable
  
• d5bvqa_ appears in SCOPe 2.06
  
• d5bvqa_ appears in the current release, SCOPe 2.08