Lineage for d5bvsa_ (5bvs A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800288Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1800547Protein automated matches [190295] (6 species)
    not a true protein
  7. 1800612Species Pygoscelis papua [TaxId:30457] [275573] (2 PDB entries)
  8. 1800615Domain d5bvsa_: 5bvs A: [275576]
    automated match to d4nnsa_
    complexed with eic

Details for d5bvsa_

PDB Entry: 5bvs (more details), 2.2 Å

PDB Description: linoleate-bound pfabp4
PDB Compounds: (A:) fatty acid-binding protein

SCOPe Domain Sequences for d5bvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bvsa_ b.60.1.2 (A:) automated matches {Pygoscelis papua [TaxId: 30457]}
mcdqfvgtwkflssenfedymkelgvgfatrkmagvakpnvtisingdvitiktestfkn
tevsfrlgeefdettaddrktknvitldngilnqvqkwdgketvikrkvmdgnlvvectm
ntvtskrvyera

SCOPe Domain Coordinates for d5bvsa_:

Click to download the PDB-style file with coordinates for d5bvsa_.
(The format of our PDB-style files is described here.)

Timeline for d5bvsa_: