Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein automated matches [190295] (6 species) not a true protein |
Species Pygoscelis papua [TaxId:30457] [275573] (2 PDB entries) |
Domain d5bvsa_: 5bvs A: [275576] automated match to d4nnsa_ complexed with eic |
PDB Entry: 5bvs (more details), 2.2 Å
SCOPe Domain Sequences for d5bvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bvsa_ b.60.1.2 (A:) automated matches {Pygoscelis papua [TaxId: 30457]} mcdqfvgtwkflssenfedymkelgvgfatrkmagvakpnvtisingdvitiktestfkn tevsfrlgeefdettaddrktknvitldngilnqvqkwdgketvikrkvmdgnlvvectm ntvtskrvyera
Timeline for d5bvsa_: