SCOPe 2.08: Domain d5bvqb_: 5bvq B:

Lineage for d5bvqb_ (5bvq B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Pygoscelis papua [TaxId:30457] [275573] (2 PDB entries)

8. Domain d5bvqb_: 5bvq B: [275574]
   automated match to d4nnsa_

Details for d5bvqb_

PDB Entry: 5bvq, 2.1 Å

PDB Description: ligand-unbound pfabp4

PDB Compounds: (B:) fatty acid-binding protein

SCOPe Domain Sequences for d5bvqb_:

Sequence; same for both SEQRES and ATOM records:

>d5bvqb_ b.60.1.2 (B:) automated matches {Pygoscelis papua [TaxId: 30457]}
mcdqfvgtwkflssenfedymkelgvgfatrkmagvakpnvtisingdvitiktestfkn
tevsfrlgeefdettaddrktknvitldngilnqvqkwdgketvikrkvmdgnlvvectm
ntvtskrvyera

Timeline for d5bvqb_:

• d5bvqb_ first appeared in SCOPe 2.05
  
• d5bvqb_ appears in SCOPe 2.07