Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Pygoscelis papua [TaxId:30457] [275571] (1 PDB entry) |
Domain d5bvta_: 5bvt A: [275572] automated match to d1kgla_ complexed with pam |
PDB Entry: 5bvt (more details), 2.31 Å
SCOPe Domain Sequences for d5bvta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bvta_ b.60.1.0 (A:) automated matches {Pygoscelis papua [TaxId: 30457]} maidaflgkwclissegfdeymkelgvgmamrkmgsmakpdvyiikdgdtitvktestfk tsqfsfklgekfeentldgrktqtlvslkddgsliqeqewdgkktiitrklvdgqlvvec dmngikcvrvyqka
Timeline for d5bvta_: