Lineage for d5bvta_ (5bvt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805728Species Pygoscelis papua [TaxId:30457] [275571] (1 PDB entry)
  8. 2805729Domain d5bvta_: 5bvt A: [275572]
    automated match to d1kgla_
    complexed with pam

Details for d5bvta_

PDB Entry: 5bvt (more details), 2.31 Å

PDB Description: palmitate-bound pfabp5
PDB Compounds: (A:) Epidermal fatty acid-binding protein

SCOPe Domain Sequences for d5bvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bvta_ b.60.1.0 (A:) automated matches {Pygoscelis papua [TaxId: 30457]}
maidaflgkwclissegfdeymkelgvgmamrkmgsmakpdvyiikdgdtitvktestfk
tsqfsfklgekfeentldgrktqtlvslkddgsliqeqewdgkktiitrklvdgqlvvec
dmngikcvrvyqka

SCOPe Domain Coordinates for d5bvta_:

Click to download the PDB-style file with coordinates for d5bvta_.
(The format of our PDB-style files is described here.)

Timeline for d5bvta_: