SCOPe 2.08: Domain d5buvb1: 5buv B:2-173

Lineage for d5buvb1 (5buv B:2-173)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (30 species)
   not a true protein

7. Species Yersinia enterocolitica [TaxId:393305] [275567] (1 PDB entry)

8. Domain d5buvb1: 5buv B:2-173 [275569]
   Other proteins in same PDB: d5buva2, d5buvb2, d5buvc2
   automated match to d2ixka_
   complexed with cyt, edo, po4

Details for d5buvb1

PDB Entry: 5buv, 1.75 Å

PDB Description: x-ray structure of wbca from yersinia enterocolitica

PDB Compounds: (B:) Putative epimerase

SCOPe Domain Sequences for d5buvb1:

Sequence; same for both SEQRES and ATOM records:

>d5buvb1 b.82.1.0 (B:2-173) automated matches {Yersinia enterocolitica [TaxId: 393305]}
iinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrsknnvirg
mhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflakgiahg
flsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcf

Timeline for d5buvb1:

• d5buvb1 first appeared in SCOPe 2.05, called d5buvb_
  
• d5buvb1 appears in SCOPe 2.07