Lineage for d5buva_ (5buv A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807602Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 1807603Protein automated matches [190388] (20 species)
    not a true protein
  7. 1807783Species Yersinia enterocolitica [TaxId:393305] [275567] (1 PDB entry)
  8. 1807784Domain d5buva_: 5buv A: [275568]
    automated match to d2ixka_
    complexed with cyt, edo, po4

Details for d5buva_

PDB Entry: 5buv (more details), 1.75 Å

PDB Description: x-ray structure of wbca from yersinia enterocolitica
PDB Compounds: (A:) Putative epimerase

SCOPe Domain Sequences for d5buva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5buva_ b.82.1.0 (A:) automated matches {Yersinia enterocolitica [TaxId: 393305]}
asiinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrsknnvi
rgmhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflakgia
hgflsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcf

SCOPe Domain Coordinates for d5buva_:

Click to download the PDB-style file with coordinates for d5buva_.
(The format of our PDB-style files is described here.)

Timeline for d5buva_:

  • d5buva_ appears in periodic updates to SCOPe 2.05 starting on 2015-08-05
  • d5buva_ is called d5buva1 in SCOPe 2.06
  • d5buva_ appears in the current release, SCOPe 2.07, called d5buva1