SCOPe 2.08: Domain d5bs1b1: 5bs1 B:34-155

Lineage for d5bs1b1 (5bs1 B:34-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.0: automated matches [191655] (1 protein)
   not a true family

6. Protein automated matches [191222] (3 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [275556] (2 PDB entries)

8. Domain d5bs1b1: 5bs1 B:34-155 [275565]
   Other proteins in same PDB: d5bs1a2, d5bs1b2
   automated match to d4gr2b_
   complexed with mg

Details for d5bs1b1

PDB Entry: 5bs1, 1.6 Å

PDB Description: crystal structure of rbcx-iia from chlamydomonas reinhardtii

PDB Compounds: (B:) CrRbcX-IIa

SCOPe Domain Sequences for d5bs1b1:

Sequence, based on SEQRES records:

>d5bs1b1 a.280.1.0 (B:34-155) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mhipadsfsgasperkaavalrslftfvaarvvleqlqgpggpettynqqayldlmdflg
tpmkgdggdewmaavmrknhalalrlmevreayldefewgktmemasretreantrlmra
aa

Sequence, based on observed residues (ATOM records):

>d5bs1b1 a.280.1.0 (B:34-155) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mhipadsfsgasperkaavalrslftfvaarvvleqlqttynqqayldlmdflgtpmkgd
ggdewmaavmrknhalalrlmevreayldefewgktmemasretreantrlmraaa

Timeline for d5bs1b1:

• d5bs1b1 first appeared in SCOPe 2.05, called d5bs1b_
  
• d5bs1b1 appears in SCOPe 2.07