Lineage for d5bs1a1 (5bs1 A:34-155)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739026Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2739027Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2739092Family a.280.1.0: automated matches [191655] (1 protein)
    not a true family
  6. 2739093Protein automated matches [191222] (3 species)
    not a true protein
  7. 2739094Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [275556] (2 PDB entries)
  8. 2739095Domain d5bs1a1: 5bs1 A:34-155 [275559]
    Other proteins in same PDB: d5bs1a2, d5bs1b2
    automated match to d4gr2b_
    complexed with mg

Details for d5bs1a1

PDB Entry: 5bs1 (more details), 1.6 Å

PDB Description: crystal structure of rbcx-iia from chlamydomonas reinhardtii
PDB Compounds: (A:) CrRbcX-IIa

SCOPe Domain Sequences for d5bs1a1:

Sequence, based on SEQRES records: (download)

>d5bs1a1 a.280.1.0 (A:34-155) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mhipadsfsgasperkaavalrslftfvaarvvleqlqgpggpettynqqayldlmdflg
tpmkgdggdewmaavmrknhalalrlmevreayldefewgktmemasretreantrlmra
aa

Sequence, based on observed residues (ATOM records): (download)

>d5bs1a1 a.280.1.0 (A:34-155) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mhipadsfsgasperkaavalrslftfvaarvvleqlqgttynqqayldlmdflgtpmkg
dggdewmaavmrknhalalrlmevreayldefewgktmemasretreantrlmraaa

SCOPe Domain Coordinates for d5bs1a1:

Click to download the PDB-style file with coordinates for d5bs1a1.
(The format of our PDB-style files is described here.)

Timeline for d5bs1a1: