SCOPe 2.08: Domain d5bs2a_: 5bs2 A:

Lineage for d5bs2a_ (5bs2 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.0: automated matches [191655] (1 protein)
   not a true family

6. Protein automated matches [191222] (3 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [275556] (2 PDB entries)

8. Domain d5bs2a_: 5bs2 A: [275558]
   automated match to d4gr2b_

Details for d5bs2a_

PDB Entry: 5bs2, 1.97 Å

PDB Description: crystal structure of rbcx-iia from chlamydomonas reinhardtii in complex with rbcl c-terminal tail

PDB Compounds: (A:) Ribulose bisphosphate carboxylase large chain,CrRbcX-IIa

SCOPe Domain Sequences for d5bs2a_:

Sequence; same for both SEQRES and ATOM records:

>d5bs2a_ a.280.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
asperkaavalrslftfvaarvvleqlqgpggpettynqqayldlmdflgtpmkgdggde
wmaavmrknhalalrlmevreayldefewgktmemasretreantrlmraaam

Timeline for d5bs2a_:

• d5bs2a_ first appeared in SCOPe 2.05
  
• d5bs2a_ appears in SCOPe 2.07