SCOPe 2.06: Domain d5a9ga2: 5a9g A:86-202

Lineage for d5a9ga2 (5a9g A:86-202)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (31 species)
   not a true protein

7. Species Sphingobacterium spiritivorum [TaxId:258] [275548] (1 PDB entry)

8. Domain d5a9ga2: 5a9g A:86-202 [275551]
   Other proteins in same PDB: d5a9ga1, d5a9ga3, d5a9gb1, d5a9gb3
   automated match to d4k2wa2
   complexed with mn

Details for d5a9ga2

PDB Entry: 5a9g, 1.35 Å

PDB Description: manganese superoxide dismutase from sphingobacterium sp. t2

PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d5a9ga2:

Sequence; same for both SEQRES and ATOM records:

>d5a9ga2 d.44.1.0 (A:86-202) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
nkgtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqd
nplmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalk

Timeline for d5a9ga2:

• d5a9ga2 first appeared in SCOPe 2.05
  
• d5a9ga2 appears in SCOPe 2.07
  
• d5a9ga2 appears in the current release, SCOPe 2.08