Lineage for d5a9ga2 (5a9g A:86-202)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946509Species Sphingobacterium spiritivorum [TaxId:258] [275548] (3 PDB entries)
  8. 2946512Domain d5a9ga2: 5a9g A:86-202 [275551]
    Other proteins in same PDB: d5a9ga1, d5a9ga3, d5a9gb1, d5a9gb3
    automated match to d4k2wa2
    complexed with mn

Details for d5a9ga2

PDB Entry: 5a9g (more details), 1.35 Å

PDB Description: manganese superoxide dismutase from sphingobacterium sp. t2
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d5a9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a9ga2 d.44.1.0 (A:86-202) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
nkgtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqd
nplmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalk

SCOPe Domain Coordinates for d5a9ga2:

Click to download the PDB-style file with coordinates for d5a9ga2.
(The format of our PDB-style files is described here.)

Timeline for d5a9ga2: