| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
| Protein automated matches [226860] (38 species) not a true protein |
| Species Sphingobacterium spiritivorum [TaxId:258] [275548] (3 PDB entries) |
| Domain d5a9ga2: 5a9g A:86-202 [275551] Other proteins in same PDB: d5a9ga1, d5a9ga3, d5a9gb1, d5a9gb3 automated match to d4k2wa2 complexed with mn |
PDB Entry: 5a9g (more details), 1.35 Å
SCOPe Domain Sequences for d5a9ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a9ga2 d.44.1.0 (A:86-202) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
nkgtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqd
nplmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalk
Timeline for d5a9ga2: