Lineage for d2qwe__ (2qwe -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies) Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins) 
Protein Influenza neuraminidase [50943] (2 species) Species Influenza A virus, different strains [TaxId:11320] [50944] (41 PDB entries) 
Domain d2qwe__: 2qwe - [27555]
Details for d2qwe__
PDB Entry: 2qwe (more details), 2 Å
PDB Description: the x-ray structure of a complex of 4-guanidino-neu5ac2en and a drug resistant variant r292k of tern n9 influenza virus neuraminidase
SCOP Domain Sequences for d2qwe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qwe__ b.68.1.1 (-) Influenza neuraminidase {Influenza A virus, different strains}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctckdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl
SCOP Domain Coordinates for d2qwe__:
Click to download the PDB-style file with coordinates for d2qwe__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qwe__:
- d2qwe__ appears in SCOP 1.57
- d2qwe__ appears in the current release, SCOPe 2.08, called d2qwea_
View in 3D