![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Sphingobacterium spiritivorum [TaxId:258] [275545] (3 PDB entries) |
![]() | Domain d5a9gb1: 5a9g B:1-85 [275546] Other proteins in same PDB: d5a9ga2, d5a9ga3, d5a9gb2, d5a9gb3 automated match to d4k2wa1 complexed with mn |
PDB Entry: 5a9g (more details), 1.35 Å
SCOPe Domain Sequences for d5a9gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a9gb1 a.2.11.0 (B:1-85) automated matches {Sphingobacterium spiritivorum [TaxId: 258]} qfkqtplpyaydalegaidaktmeihyskhaagytanlnkaiagtpaekesienilakvs qysdavrnnagghynhelfwsiltp
Timeline for d5a9gb1: