Lineage for d5a9gb1 (5a9g B:1-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690556Species Sphingobacterium spiritivorum [TaxId:258] [275545] (3 PDB entries)
  8. 2690560Domain d5a9gb1: 5a9g B:1-85 [275546]
    Other proteins in same PDB: d5a9ga2, d5a9ga3, d5a9gb2, d5a9gb3
    automated match to d4k2wa1
    complexed with mn

Details for d5a9gb1

PDB Entry: 5a9g (more details), 1.35 Å

PDB Description: manganese superoxide dismutase from sphingobacterium sp. t2
PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d5a9gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a9gb1 a.2.11.0 (B:1-85) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
qfkqtplpyaydalegaidaktmeihyskhaagytanlnkaiagtpaekesienilakvs
qysdavrnnagghynhelfwsiltp

SCOPe Domain Coordinates for d5a9gb1:

Click to download the PDB-style file with coordinates for d5a9gb1.
(The format of our PDB-style files is described here.)

Timeline for d5a9gb1: