SCOPe 2.08: Domain d5a65a1: 5a65 A:3-214

Lineage for d5a65a1 (5a65 A:3-214)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.2: CYTH domain [118007] (5 proteins)
   Pfam PF01928

6. Protein automated matches [190597] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [275537] (1 PDB entry)

8. Domain d5a65a1: 5a65 A:3-214 [275540]
   Other proteins in same PDB: d5a65a2, d5a65b2
   automated match to d3bhda_
   complexed with edo, mg, po4, tpp

Details for d5a65a1

PDB Entry: 5a65, 1.98 Å

PDB Description: crystal structure of mouse thiamine triphosphatase in complex with thiamine diphosphate, orthophosphate and magnesium ions.

PDB Compounds: (A:) Thiamine triphosphatase

SCOPe Domain Sequences for d5a65a1:

Sequence, based on SEQRES records:

>d5a65a1 d.63.1.2 (A:3-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgw
elkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfi
ttrsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvssml
gvpaqeeapaklmvylqrfrpldyqrlleaas

Sequence, based on observed residues (ATOM records):

>d5a65a1 d.63.1.2 (A:3-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgw
elkcpgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfittr
sswklalsepqltidldsadfgyavgeveamvhekaevpaalekiitvssmlgvpaqeea
paklmvylqrfrpldyqrlleaas

Timeline for d5a65a1:

• d5a65a1 first appeared in SCOPe 2.05, called d5a65a_
  
• d5a65a1 appears in SCOPe 2.07