Lineage for d5a64a_ (5a64 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563399Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2563400Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2563414Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 2563429Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species)
  7. 2563435Species Mouse (Mus musculus) [TaxId:10090] [160429] (2 PDB entries)
    Uniprot Q8JZL3 2-224
  8. 2563436Domain d5a64a_: 5a64 A: [275536]
    automated match to d2jmua1
    complexed with edo, pge, v4e

Details for d5a64a_

PDB Entry: 5a64 (more details), 2.1 Å

PDB Description: crystal structure of mouse thiamine triphosphatase in complex with thiamine triphosphate.
PDB Compounds: (A:) Thiamine triphosphatase

SCOPe Domain Sequences for d5a64a_:

Sequence, based on SEQRES records: (download)

>d5a64a_ d.63.1.2 (A:) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]}
glieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwe
lkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfit
trsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvssmlg
vpaqeeapaklmvylqrfrpldyqrlleaass

Sequence, based on observed residues (ATOM records): (download)

>d5a64a_ d.63.1.2 (A:) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]}
glieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwe
lkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfit
trsswklaqltidldsadfgyavgeveamvhekaevpaalekiitvssmlgvpaqeeapa
klmvylqrfrpldyqrlleaass

SCOPe Domain Coordinates for d5a64a_:

Click to download the PDB-style file with coordinates for d5a64a_.
(The format of our PDB-style files is described here.)

Timeline for d5a64a_: