![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
![]() | Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) ![]() |
![]() | Family d.63.1.2: CYTH domain [118007] (5 proteins) Pfam PF01928 |
![]() | Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [160429] (2 PDB entries) Uniprot Q8JZL3 2-224 |
![]() | Domain d5a64b_: 5a64 B: [275535] automated match to d2jmua1 complexed with edo, pge, v4e |
PDB Entry: 5a64 (more details), 2.1 Å
SCOPe Domain Sequences for d5a64b_:
Sequence, based on SEQRES records: (download)
>d5a64b_ d.63.1.2 (B:) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]} glieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwe lkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfit trsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvssmlg vpaqeeapaklmvylqrfrpldyqrllea
>d5a64b_ d.63.1.2 (B:) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]} glieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwe lkcphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfittrsswkla qltidldsadfgyavgeveamvhekaevpaalekiitvssmlgvpaqeeapaklmvylqr frpldyqrllea
Timeline for d5a64b_: