Lineage for d5a64b_ (5a64 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956671Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2956672Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2956686Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 2956701Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species)
  7. 2956707Species Mouse (Mus musculus) [TaxId:10090] [160429] (2 PDB entries)
    Uniprot Q8JZL3 2-224
  8. 2956709Domain d5a64b_: 5a64 B: [275535]
    automated match to d2jmua1
    complexed with edo, pge, v4e

Details for d5a64b_

PDB Entry: 5a64 (more details), 2.1 Å

PDB Description: crystal structure of mouse thiamine triphosphatase in complex with thiamine triphosphate.
PDB Compounds: (B:) Thiamine triphosphatase

SCOPe Domain Sequences for d5a64b_:

Sequence, based on SEQRES records: (download)

>d5a64b_ d.63.1.2 (B:) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]}
glieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwe
lkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfit
trsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvssmlg
vpaqeeapaklmvylqrfrpldyqrllea

Sequence, based on observed residues (ATOM records): (download)

>d5a64b_ d.63.1.2 (B:) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]}
glieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwe
lkcphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfittrsswkla
qltidldsadfgyavgeveamvhekaevpaalekiitvssmlgvpaqeeapaklmvylqr
frpldyqrllea

SCOPe Domain Coordinates for d5a64b_:

Click to download the PDB-style file with coordinates for d5a64b_.
(The format of our PDB-style files is described here.)

Timeline for d5a64b_: