SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4zz9b_ (4zz9 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078563Protein Triosephosphate isomerase [51353] (20 species)
  7. 2078644Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (29 PDB entries)
    Uniprot Q07412
  8. 2078680Domain d4zz9b_: 4zz9 B: [275534]
    automated match to d2vfha_
    complexed with edo, na; mutant

Details for d4zz9b_

PDB Entry: 4zz9 (more details), 1.81 Å

PDB Description: crystal structure of t75s mutant of triosephosphate isomerase from plasmodium falciparum
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d4zz9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zz9b_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
giqnvskfgngsysgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnl
kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
diiksam

SCOPe Domain Coordinates for d4zz9b_:

Click to download the PDB-style file with coordinates for d4zz9b_.
(The format of our PDB-style files is described here.)

Timeline for d4zz9b_: