Lineage for d4zz9b_ (4zz9 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078563Protein Triosephosphate isomerase [51353] (20 species)
  7. 2078644Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (30 PDB entries)
    Uniprot Q07412
  8. 2078680Domain d4zz9b_: 4zz9 B: [275534]
    automated match to d2vfha_
    complexed with edo, na; mutant

Details for d4zz9b_

PDB Entry: 4zz9 (more details), 1.81 Å

PDB Description: crystal structure of t75s mutant of triosephosphate isomerase from plasmodium falciparum
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d4zz9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zz9b_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
giqnvskfgngsysgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnl
kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
diiksam

SCOPe Domain Coordinates for d4zz9b_:

Click to download the PDB-style file with coordinates for d4zz9b_.
(The format of our PDB-style files is described here.)

Timeline for d4zz9b_: