SCOPe 2.05: Domain d4zykb1: 4zyk B:1-106

Lineage for d4zykb1 (4zyk B:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4zykb1: 4zyk B:1-106 [275531]
   Other proteins in same PDB: d4zykb2, d4zykl2
   automated match to d1dn0a1
   complexed with act, edo, so4

Details for d4zykb1

PDB Entry: 4zyk, 2 Å

PDB Description: crystal structure of quaternary-specific rsv-neutralizing human antibody am14

PDB Compounds: (B:) AM14 light chain

SCOPe Domain Sequences for d4zykb1:

Sequence; same for both SEQRES and ATOM records:

>d4zykb1 b.1.1.0 (B:1-106) automated matches {Homo sapiens [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdikkylnwyhqkpgkvpellmhdasnletgvps
rfsgrgsgtdftltisslqpedigtyycqqydnlppltfgggtkvei

Timeline for d4zykb1:

• d4zykb1 is new in SCOPe 2.05-stable
  
• d4zykb1 appears in SCOPe 2.06
  
• d4zykb1 appears in the current release, SCOPe 2.08