SCOPe 2.05: Domain d4ziae_: 4zia E:

Lineage for d4ziae_ (4zia E:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.90: Transcription factor STAT-4 N-domain [48091] (1 superfamily)
   multihelical; can be divided into two subdomains

4. Superfamily a.90.1: Transcription factor STAT-4 N-domain [48092] (2 families)
   automatically mapped to Pfam PF02865

5. Family a.90.1.0: automated matches [274641] (1 protein)
   not a true family

6. Protein automated matches [274642] (2 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [275519] (1 PDB entry)

8. Domain d4ziae_: 4zia E: [275524]
   automated match to d1bgfa_
   complexed with fmt, mg, ni

Details for d4ziae_

PDB Entry: 4zia, 2.7 Å

PDB Description: crystal structure of stat3 n-terminal domain

PDB Compounds: (E:) Signal transducer and activator of transcription 3

SCOPe Domain Sequences for d4ziae_:

Sequence; same for both SEQRES and ATOM records:

>d4ziae_ a.90.1.0 (E:) automated matches {Mus musculus [TaxId: 10090]}
pgsqwnqlqqldtryleqlhqlysdsfpmelrqflapwiesqdwayaaskeshatlvfhn
llgeidqqysrflqesnvlyqhnlrrikqflqsrylekpmeiarivarclweesrllqta
ata

Timeline for d4ziae_:

• d4ziae_ is new in SCOPe 2.05-stable
  
• d4ziae_ is called d4ziae1 in SCOPe 2.06
  
• d4ziae_ appears in the current release, SCOPe 2.08, called d4ziae1