Lineage for d4ziab1 (4zia B:3-124)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328072Fold a.90: Transcription factor STAT-4 N-domain [48091] (1 superfamily)
    multihelical; can be divided into two subdomains
  4. 2328073Superfamily a.90.1: Transcription factor STAT-4 N-domain [48092] (2 families) (S)
    automatically mapped to Pfam PF02865
  5. 2328078Family a.90.1.0: automated matches [274641] (1 protein)
    not a true family
  6. 2328079Protein automated matches [274642] (2 species)
    not a true protein
  7. 2328082Species Mouse (Mus musculus) [TaxId:10090] [275519] (1 PDB entry)
  8. 2328084Domain d4ziab1: 4zia B:3-124 [275521]
    Other proteins in same PDB: d4ziaa2, d4ziab2, d4ziac2, d4ziad2, d4ziae2
    automated match to d1bgfa_
    complexed with fmt, mg, ni

Details for d4ziab1

PDB Entry: 4zia (more details), 2.7 Å

PDB Description: crystal structure of stat3 n-terminal domain
PDB Compounds: (B:) Signal transducer and activator of transcription 3

SCOPe Domain Sequences for d4ziab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ziab1 a.90.1.0 (B:3-124) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qwnqlqqldtryleqlhqlysdsfpmelrqflapwiesqdwayaaskeshatlvfhnllg
eidqqysrflqesnvlyqhnlrrikqflqsrylekpmeiarivarclweesrllqtaata
aq

SCOPe Domain Coordinates for d4ziab1:

Click to download the PDB-style file with coordinates for d4ziab1.
(The format of our PDB-style files is described here.)

Timeline for d4ziab1: