Lineage for d2qwg__ (2qwg -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62716Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 62717Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 62718Protein Influenza neuraminidase [50943] (2 species)
  7. 62719Species Influenza A virus, different strains [TaxId:11320] [50944] (45 PDB entries)
  8. 62728Domain d2qwg__: 2qwg - [27552]

Details for d2qwg__

PDB Entry: 2qwg (more details), 1.8 Å

PDB Description: the x-ray structure of a complex of 5-n-acetyl-4-amino-6- diethylcarboxamide-4,5-dihydro-2h-pyran-2-carboxylic acid and a drug resistant variant r292k of tern n9 influenza virus neuraminidase

SCOP Domain Sequences for d2qwg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwg__ b.68.1.1 (-) Influenza neuraminidase {Influenza A virus, different strains}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctckdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d2qwg__:

Click to download the PDB-style file with coordinates for d2qwg__.
(The format of our PDB-style files is described here.)

Timeline for d2qwg__: