Lineage for d4xz5d_ (4xz5 D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2078811Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2078812Protein automated matches [191011] (13 species)
    not a true protein
  7. 2078945Species Thiomicrospira crunogena [TaxId:317025] [275505] (1 PDB entry)
  8. 2078949Domain d4xz5d_: 4xz5 D: [275510]
    automated match to d3iaib_
    complexed with bct, zn

Details for d4xz5d_

PDB Entry: 4xz5 (more details), 2.6 Å

PDB Description: structure of the thermostable alpha-carbonic anydrase from thiomicrospira crunogena xcl-2 gammaproteobacterium
PDB Compounds: (D:) Carbonic anhydrase, alpha family

SCOPe Domain Sequences for d4xz5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xz5d_ b.74.1.0 (D:) automated matches {Thiomicrospira crunogena [TaxId: 317025]}
pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpd

SCOPe Domain Coordinates for d4xz5d_:

Click to download the PDB-style file with coordinates for d4xz5d_.
(The format of our PDB-style files is described here.)

Timeline for d4xz5d_: