Lineage for d2qwk__ (2qwk -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17045Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 17046Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins)
  6. 17047Protein Influenza neuraminidase [50943] (2 species)
  7. 17048Species Influenza A virus, different strains [TaxId:11320] [50944] (41 PDB entries)
  8. 17054Domain d2qwk__: 2qwk - [27551]

Details for d2qwk__

PDB Entry: 2qwk (more details), 1.8 Å

PDB Description: the x-ray structure of a complex of 5-n-acetyl-5-amino-3-(1-ethylpropoxy)-1-cyclohexene-1-carboxylic acid (gs4071) and wildtype tern n9 influenza virus neuraminidase

SCOP Domain Sequences for d2qwk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwk__ b.68.1.1 (-) Influenza neuraminidase {Influenza A virus, different strains}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d2qwk__:

Click to download the PDB-style file with coordinates for d2qwk__.
(The format of our PDB-style files is described here.)

Timeline for d2qwk__: